DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP705A1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_193268.3 Gene:CYP705A1 / 827199 AraportID:AT4G15330 Length:513 Species:Arabidopsis thaliana


Alignment Length:521 Identity:106/521 - (20%)
Similarity:197/521 - (37%) Gaps:124/521 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGN-----ANRIGKNPAEILSTFFDWWY 64
            ::.|....||:...|.:|......||.   .|..:||:|:     :..|.|:..::.|.:     
plant    14 IILLCSFSLISYFVFFKKPKVNFDLLP---SPPSLPIIGHLHLLLSTLIHKSLQKLSSKY----- 70

  Fly    65 DYGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDL---------------LHPWLGH 114
                       |...|:.:.|   :.:||.|..    |..|::               :...|..
plant    71 -----------GPLLHLRIFN---IPFILVSSD----SLAYEIFRDHDVNVSSRGVGAIDESLAF 117

  Fly   115 G----LLTSFGSKWHKHRKMITPSFHFNIL--------QDFHEVMNENSAKFMTQL-KKASAGDT 166
            |    :...:|..|...:|:|..    .:|        |||.   :|...:|..:| .||...::
plant   118 GSSGFIQAPYGDYWKFMKKLIAT----KLLGPQPLVRSQDFR---SEELERFYKRLFDKAMKKES 175

  Fly   167 IIDFQEHANYL--TLDVIC-DTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFS 228
            ::..:|.:.::  :|..:| ..:..|..|.:|                             |:..
plant   176 VMIHKEASRFVNNSLYKMCTGRSFSVENNEVE-----------------------------RIME 211

  Fly   229 LTPEFSA----------YQKTLKTLQDFTYD----IIEKRVYALQNGGSKEDHDPSLPRKKMAFL 279
            ||.:..|          ::|.|:.|....:.    ::.:|...|......|..:.....:...|:
plant   212 LTADLGALSQKFFVSKMFRKLLEKLGISLFKTEIMVVSRRFSELVERILIEYEEKMDGHQGTQFM 276

  Fly   280 DTLLSSTIDGR---PLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVM 341
            |.||::..|..   .:||..|...::.|.....|.::..:.:::..:..:.::..||..|...|:
plant   277 DALLAAYRDENTEYKITRSHIKSLLTEFFIGAADASSIAIQWAMADIINNREILEKLREEIDSVV 341

  Fly   342 GHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLG 406
            |  ..|.|...::..:.||...:||..|::|..|.:.|...:..:|.|..|||.|||.:....:.
plant   342 G--KTRLVQETDLPNLPYLQAVVKEGLRLHPPTPLVVREFQEGCEIGGFFVPKNTTLIVNSYAMM 404

  Fly   407 YNDRIFKDPHHFRPERF-------EEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSF 464
            .:...::||..|:||||       |::|.....:|||.:|.|.|.|.....:.:.|.|..:|:.|
plant   405 RDPDSWQDPDEFKPERFLASLSREEDKKEKILNFLPFGSGRRMCPGSNLGYIFVGTAIGMMVQCF 469

  Fly   465 E 465
            :
plant   470 D 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 99/491 (20%)
CYP705A1NP_193268.3 CYP93 71..499 CDD:410748 92/445 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.