DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP710A3

DIOPT Version :10

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_180451.1 Gene:CYP710A3 / 817434 AraportID:AT2G28850 Length:493 Species:Arabidopsis thaliana


Alignment Length:99 Identity:24/99 - (24%)
Similarity:33/99 - (33%) Gaps:29/99 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HGSNLRVAYQGVPGAYSEAAAGKAYPNCQAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHR 176
            |...::..|.|.|...|        |..|..||        ||..           :...||.: 
plant    50 HPGQIQDFYHGTPSLSS--------PTYQQNPC--------AVTC-----------HGDPGSFY- 86

  Fly   177 NYDLLLRHRLHIVGEVQLPVH-HCLLALPGVRKE 209
            .||.|.|..|....:.:|..: .|.||..|:.:|
plant    87 GYDPLQRQSLFSSQDTELVQYSECKLASAGLGEE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 CYP4 68..519 CDD:410721 24/99 (24%)
CYP710A3NP_180451.1 CYP61_CYP710 73..481 CDD:410703 17/68 (25%)

Return to query results.
Submit another query.