DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP4F11

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:482 Identity:144/482 - (29%)
Similarity:247/482 - (51%) Gaps:50/482 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KNPAEILSTFFDWWYDYGKDNFLFWIGYS-SHIVMTNPKQLEYILNSQQLI--QKSTIYDLLHPW 111
            |...::::|:        ...|..|:|.: ..:::.:|..:..|.::...:  :....|..|.||
Human    75 KTLTQLVTTY--------PQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPW 131

  Fly   112 LGHGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQ--LKKASAGDTIIDFQEHA 174
            ||.|||.|.|.||.:||:|:||:||||||:.:.::.|: |...|..  .:.||.|...:|..||.
Human   132 LGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNK-SVNIMHDKWQRLASEGSARLDMFEHI 195

  Fly   175 NYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKT 239
            :.:|||.:.........|..| :.|..:.|..::...:..|.......::.::.|||:...:::.
Human   196 SLMTLDSLQKCVFSFESNCQE-KPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRA 259

  Fly   240 LKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDT-LLSSTIDGRPLTRQEIYEEVST 303
            ...:.|||..:|::|...|...|..:........|.:.|:|. |||...||:.|:.::|..|..|
Human   260 CHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADT 324

  Fly   304 FMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQ 368
            |||||||||.||:|:.:|.|::||:.|.:..:|..|::.......:.:.::|::.:|.:.|||:.
Human   325 FMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESL 389

  Fly   369 RVYPSVPFIGRYCDKDYDI-NGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEE---KPA 429
            |::|.||.|.|.|.:|:.: :|.::|||....:.:|.:.||..::.||..:.|.||::|   :.:
Human   390 RLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQENIKERS 454

  Fly   430 PFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKR 494
            |..::||||||||||||.||:.|:|.|::..:..|.:||...|                      
Human   455 PLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPTHTE---------------------- 497

  Fly   495 EAGRHKYDPILSAVLTLKSDNGLHLRL 521
                    |.....|.|:::.||.||:
Human   498 --------PRRKPELILRAEGGLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 134/427 (31%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 139/470 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154761
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.