DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp3a25

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_062766.2 Gene:Cyp3a25 / 56388 MGIID:1930638 Length:503 Species:Mus musculus


Alignment Length:529 Identity:134/529 - (25%)
Similarity:247/529 - (46%) Gaps:74/529 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLPLITLVYFERKASQRRQLLKEFN--GPTPVPILGNANRIGKNPAEILSTFFD--WWYD----- 65
            ||.:.:||.|....:....|.|:..  ||.|:|:||.           :..::|  |.:|     
Mouse    13 VLLVTSLVLFYIYGTYSHGLFKKLGIPGPKPLPLLGT-----------IFNYYDGMWKFDEDCYK 66

  Fly    66 -YGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHP--WLGHGLLTSFGSKWHKH 127
             ||| .:.|:.|....:.:.:|:.::.:| .::.....|......|  ::...:..|...:|.:.
Mouse    67 KYGK-IWGFYEGPQPILAIMDPEIIKIVL-VKECYSVFTNRRFFGPVGFMKKAITISEDEEWKRL 129

  Fly   128 RKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPIN 192
            |.:::|:|....|::...:|.:.....:..|::.......|..::.....::|||..|:.||.::
Mouse   130 RTLLSPTFTSGKLKEMFPIMRQYGDILVRNLRREEEKGEPISMKDIFGAYSMDVITGTSFGVNVD 194

  Fly   193 AMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFS-LTP-----EFSAYQK-TLKTLQDFTYDI 250
            ::.......||..:.:   :..:.|.||..|..:|. |||     .||.:.: ::...:.|.   
Mouse   195 SLNNPQDPFVQKAKKI---LKFKIFDPFLLSIILFPFLTPIYEMLNFSIFPRDSMNFFKKFV--- 253

  Fly   251 IEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSS-----TIDGRPLTRQEIYEEVSTFMFEGHD 310
              ||:        |::...|..:.::.||..::::     ....:.|:..|:..:...|:|.|:|
Mouse   254 --KRM--------KKERLASNQKNRVDFLQLMMNTQNSKGQESQKALSDLEMAAQAVIFIFGGYD 308

  Fly   311 TTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRS-VSFQEIAKMKYLDLFIKEAQRVYPSV 374
            .|::.:|..:|.|:.|||||:||   |.|:.....|:: |::..:..|:|||:.:.|:.|:||..
Mouse   309 ATSTSISLIMYELATHPDVQKKL---QDEIDRTLPNKAPVTYDALMDMEYLDMVVNESLRLYPIA 370

  Fly   375 PFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPA---PFEYLPF 436
            ..:.|...||.:|||..:||||.:.:.:..|..|...:.:|..|.||||.:|...   |:.|:||
Mouse   371 IRLERVSKKDVEINGVFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPERFSKENKGNIDPYIYMPF 435

  Fly   437 SAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGRHKY 501
            ..|||||||.:|||:.:|..:..|:::|.|.|..:          |.:.|    |:.||......
Mouse   436 GNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEE----------TQIPL----KISREPIFQPE 486

  Fly   502 DPILSAVLT 510
            .||:..|::
Mouse   487 KPIILKVVS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 118/458 (26%)
Cyp3a25NP_062766.2 p450 39..493 CDD:278495 126/499 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.