DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp2c67

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001019890.1 Gene:Cyp2c67 / 545288 MGIID:3612288 Length:491 Species:Mus musculus


Alignment Length:516 Identity:118/516 - (22%)
Similarity:209/516 - (40%) Gaps:106/516 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIG-KNPAEILSTFFDWWYDYGK 68
            |:.:|.|..:.::...|:.|.|..|..   ||||:||:||.:.|. |:..:.|:.|..   .|| 
Mouse     5 VVLVLCLSFLLVLSLWRQRSARGNLPP---GPTPLPIIGNYHLIDMKDIGQCLTNFSK---TYG- 62

  Fly    69 DNFLFWIGYSSHIVMTNPKQLE--YILNSQQLIQKS--TIYDLLHPWLGHGLLTSFGSKWHKHRK 129
            ..|..:.|....:|:...:.::  :|.:.::...:.  ..:|.:..  |.|:..|.|:.|     
Mouse    63 PVFTLYFGSQPIVVLHGYEAMKEAFIDHGEEFSGRGRFPFFDKVTK--GKGIGFSHGNVW----- 120

  Fly   130 MITPSFHFNILQD-------FHEVMNENSAKFMTQLKKASA-------------GDTI--IDFQE 172
            ..|..|..|.|::       ....:.|.:...|.:|||.:.             .:.|  |.||.
Mouse   121 KATRVFTINTLRNLGMGKRTIENKVQEEAQWLMKELKKTNGLPCDPQFIIGCAPCNVICSIVFQN 185

  Fly   173 HANYLTLDVICDTAMGVPINAMEQRDSSIVQAFR------DMCYNINMRAFHPFKRSNRVFSLTP 231
            ..:|...|.:  :.:|......|...|...|.|.      |.|..          |.|:.|....
Mouse   186 RFDYKDKDFL--SLIGKVNECTEILSSPGCQIFNAVPILIDYCPG----------RHNKFFKNHT 238

  Fly   232 EFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSL----PRKKMAFLDTLL-----SSTI 287
            ...:|             ::||          .::|:.||    ||.   |:|..|     ...|
Mouse   239 WIKSY-------------LLEK----------IKEHEESLDVTNPRD---FIDYFLIQRCQEKGI 277

  Fly   288 DGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQ 352
            :....|.:.:...|:..:|.|.::.:|.:.|::.||.:|..:..|:..|...|:|.  :||...|
Mouse   278 EHMEYTIEHLATLVTDLVFGGTESLSSTMRFALLLLMKHTHITAKVQEEIDNVIGR--HRSPCMQ 340

  Fly   353 EIAKMKYLDLFIKEAQRVYPSVPFIGRY---CDKDYDINGSIVPKGTTLNLALILLGYNDRIFKD 414
            :...|.|.:..:.|.||.....|....:   ||..:  ....:||||.:..:|..:.::...|.:
Mouse   341 DRNHMPYTNAMVHEVQRYVDLGPISLVHEVTCDTKF--RNYFIPKGTQVMTSLTSVLHDSTEFPN 403

  Fly   415 PHHFRPERFEEE----KPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVD 471
            |..|.|..|.::    |.:.: ::|||||.|.|:|:..|.:||...::.::::|::.|.||
Mouse   404 PEVFDPGHFLDDNGNFKKSDY-FVPFSAGKRICVGESLARMELFLFLTTILQNFKLKPLVD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 108/481 (22%)
Cyp2c67NP_001019890.1 p450 30..487 CDD:278495 111/491 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.