DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and cyp3c3

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001007401.2 Gene:cyp3c3 / 492759 ZFINID:ZDB-GENE-041114-102 Length:503 Species:Danio rerio


Alignment Length:515 Identity:122/515 - (23%)
Similarity:215/515 - (41%) Gaps:102/515 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAVLALLVLPLITLVY--------FERKASQRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTF 59
            |:|...||..:|||:|        |.:|..        ..||.|.|..|......|.       |
Zfish     7 LSVTWTLVFLVITLLYMYGVWPHGFFKKLG--------IPGPRPWPFFGTFLSYTKG-------F 56

  Fly    60 FDWWYDYGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIY-----------DLLHPWLG 113
            |::..:..|.....|..|...:.:.....||.|    :.|.....|           ||..| |.
Zfish    57 FNFDMECAKKYGKVWGIYDGRLPILMVTDLEMI----KTIMVKECYSTFTNRREVNVDLAGP-LA 116

  Fly   114 HGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLT 178
            .|:......:|.:.|..::|.|....|::...:...::.:|:..::|.. .:..:..:|.....:
Zfish   117 DGISAVKDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKRD-HEQPVKIKEVVAPYS 180

  Fly   179 LDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPF---------------KRSNRVFS 228
            |||:..::..|.|:::...|...|...::.   :....|.|.               |....|||
Zfish   181 LDVVTSSSFSVDIDSINNPDDPFVTNIKNF---LKFSLFSPLILFLTLFPSIANLLGKMGISVFS 242

  Fly   229 LTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFL-------------- 279
                        :::.:|.|..:.|         .|::|..|  ..::.||              
Zfish   243 ------------RSIMNFFYTALRK---------IKDEHKDS--NGRVDFLRLMIQNQIPDDQAK 284

  Fly   280 DTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHD 344
            ||.....:.|  ||..||..:...|:..|::||::.:||.::.|:.:||...||..|..:  ...
Zfish   285 DTTSEQPVKG--LTDHEILSQSFIFILGGYETTSTTLSFLLHNLATNPDCLEKLVEEIDK--NFP 345

  Fly   345 MNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYND 409
            ::..:|:..:.||.||::.|.|:.|:.|:.|.:.|.|.|..::||..:||.|.:.:...:|..:.
Zfish   346 LDTPISYDALMKMDYLEMSINESMRLLPTAPRLERVCKKTVELNGITIPKDTLVAIPTYVLNRDP 410

  Fly   410 RIFKDPHHFRPERFEEEKPAPF---EYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEV 466
            :::..|..||||||..|..:.|   .::||..|||||||.:|||:.:|.::.|::::|.:
Zfish   411 QLWDSPQEFRPERFSPENKSEFLQYAFMPFGLGPRNCIGMRFALMIVKLLVVKLLQNFSL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 112/475 (24%)
cyp3c3NP_001007401.2 p450 38..496 CDD:278495 112/476 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.