DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp313a5

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster


Alignment Length:477 Identity:130/477 - (27%)
Similarity:220/477 - (46%) Gaps:48/477 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LITLVYFERKA---------SQRR---QLLKEFNGPTPVPILGNANRIGKNPAEI-LSTFFDWWY 64
            ::||..||..|         |:||   .:|| ..||...|.:|.|....:...:| |.|..  :.
  Fly     1 MLTLQIFEAFAIILCVYFLWSRRRFYIMMLK-LPGPMGFPFIGLAFEYIRLKRKIRLRTIL--FK 62

  Fly    65 DYGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYD-LLHPWLGHGLLTSFGSKWHKHR 128
            .||| ..|.|||.:..:|...||.||.|..|.....:|::.| .:...||.||||...:.|::.|
  Fly    63 IYGK-TVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLLTLKNNHWNERR 126

  Fly   129 KMITPSFHFNILQDFHEVMNENSAKFMTQL--KKASAGDTIIDFQEHANYLTLDVICDTAMGVPI 191
            |::.|||..|.:..|..|:| |.|.|:..|  :....||  |:.....|..:..:.....||..:
  Fly   127 KLLLPSFKNNAVLSFVPVLN-NEANFLVTLLAEFVDGGD--INLLPELNKWSFKIAAQITMGDEV 188

  Fly   192 -NAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQD---FTYDIIE 252
             |....::.:::::::.:...|.:....|:.|:..:..|   ||..::.|:....   |..|||:
  Fly   189 RNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKL---FSYEKRRLEAATQSNAFIKDIID 250

  Fly   253 KRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVS 317
            |::.:..|..     :|:|       :|.:|:....|. |:..::..|.|..:|...||.:..|:
  Fly   251 KKLSSTDNSS-----EPAL-------IDRILNLVRIGE-LSYDDVMGEFSNIIFAASDTLSITVN 302

  Fly   318 FSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCD 382
            ..:.|::..|..|..::.|..||.........|..::.|:..||..:.|..|:.|:||.:.|...
  Fly   303 NVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPAVPLLIRQTS 367

  Fly   383 KDYDI-NGSIVPKGTTLNLALILLGYNDRIF-KDPHHFRPERF-EEEKPA--PFEYLPFSAGPRN 442
            ....: ||..:|:|.||.:.:.....|..|: ...:.|.|:.| .|.|.|  |:.|||||.|.:.
  Fly   368 HSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLPFSKGKKT 432

  Fly   443 CIGQKFALLELKTVISKVVRSF 464
            |:|.|.:|:..|..::|::|::
  Fly   433 CLGWKLSLISAKLALAKILRNY 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 120/443 (27%)
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 120/444 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.