DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP4F3

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:465 Identity:142/465 - (30%)
Similarity:243/465 - (52%) Gaps:46/465 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DNFLFWIG-YSSHIVMTNPKQLEYILNSQQLI--QKSTIYDLLHPWLGHGLLTSFGSKWHKHRKM 130
            |...:|:| :.:.:.:.:|..::.:|.:...|  :....|..|.||||.|||.|.|.||.:||:|
Human    86 DMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRM 150

  Fly   131 ITPSFHFNILQDFHEVMNEN----SAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPI 191
            :||:||||||:.:.::.||:    .||:  || .||.|...:|..||.:.:|||.:.........
Human   151 LTPAFHFNILKPYMKIFNESVNIMHAKW--QL-LASEGSARLDMFEHISLMTLDSLQKCVFSFDS 212

  Fly   192 NAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVY 256
            :..| :.|..:.|..::...:..|........:.::.|||:...:::..:.:.|||..:|::|..
Human   213 HCQE-KPSEYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRR 276

  Fly   257 ALQNGGSKEDHDPSLPRKKMAFLDT-LLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSV 320
            .|.:.|..:........|.:.|:|. |||...||:.|:.::|..|..||||||||||.||:|:.:
Human   277 TLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVL 341

  Fly   321 YLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDY 385
            |.|::||:.|.:..:|..|::.....:.:.:.::|::.:|.:.|||:.|::|.||.:.|.|.:|.
Human   342 YHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDI 406

  Fly   386 DI-NGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEE---EKPAPFEYLPFSAGPRNCIGQ 446
            .: :|.::|||....:::....:|..::.||..:.|.||:.   ::.:|..::||||||||||||
Human   407 VLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQ 471

  Fly   447 KFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGRHKYDPILSAVLTL 511
            .||:.|:|.|:...:..|.|||...|                              |.....|.|
Human   472 AFAMAEMKVVLGLTLLRFRVLPDHTE------------------------------PRRKPELVL 506

  Fly   512 KSDNGLHLRL 521
            :::.||.||:
Human   507 RAEGGLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 132/410 (32%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 140/462 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.