DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:470 Identity:103/470 - (21%)
Similarity:194/470 - (41%) Gaps:71/470 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FWIGYSSHIVMTNPKQLEYIL--NSQQLIQKSTIYDLLHPWLGHGLLTSFGSK---WHKHRKMIT 132
            |:|..:..:::.:|:.:..:|  |....:.:....|...|.   |.||...:|   |.:.|:.::
  Fly    75 FFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPM---GALTLPLAKYHHWKESRQCMS 136

  Fly   133 PSFHFNILQDFHEVMNENSAKFMTQLKKASAGD---TIIDFQEHANYLTLDVICDTAMGVPINAM 194
            ..|....::|.......:.|..:.|......||   .::.........|.||..:....:.:..:
  Fly   137 QLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGGL 201

  Fly   195 EQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQ 259
            .:..|.::...::: :|.|.|....|.   .||.| |:::...|.    :.||.|      ||..
  Fly   202 RRGRSELITKTKEL-FNTNPRKVLDFM---SVFFL-PKWTGVLKP----KVFTED------YARY 251

  Fly   260 NGGSKED-HDPS---LPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSV 320
            .....:| |:|:   |..:...|..:..|:.....|   ..:..:....:..|.:|:::.:.|::
  Fly   252 MRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHP---DFVASQAGIILLAGFETSSALMGFTL 313

  Fly   321 YLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDY 385
            |.|::.||:|.:|..|..|..  ....::|:..:..:.||.:...||.|:||:..|:.|.|....
  Fly   314 YELAKAPDIQERLRSELREAF--ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSA 376

  Fly   386 DINGS-------IVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPA---PFEYLPFSAGP 440
            ....|       |||.|....::::.|..::|.:.:|..|.||||..|:..   |..|:||.|||
  Fly   377 SEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGP 441

  Fly   441 RNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGRHKYDPIL 505
            ..|||.:..:|:||..|..:::.:.|                       |..:|.....:::|  
  Fly   442 HGCIGSRLGVLQLKLGIVHILKQYWV-----------------------ETCERTVSEIRFNP-- 481

  Fly   506 SAVLTLKSDNGLHLR 520
             ....|:|:|.::||
  Fly   482 -KSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 95/416 (23%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 98/459 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.