DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:XP_006240610.1 Gene:Cyp46a1 / 362782 RGDID:1306605 Length:500 Species:Rattus norvegicus


Alignment Length:508 Identity:122/508 - (24%)
Similarity:227/508 - (44%) Gaps:99/508 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PTPVPILGNANRIGKNPAE----ILSTFFDWWYDYG---KDNFLFWIGYSSHIVMTNPKQLEYIL 93
            |.|..:||:.....|....    :...|.||...||   :.|    :.:.:.:::|:|:.::..|
  Rat    37 PRPSFLLGHLPYFWKKDEACGRVLQDVFLDWAKKYGPVVRVN----VFHKTSVIVTSPESVKKFL 97

  Fly    94 NSQQLIQKSTIYDLLHP-----WLGHGLLT--SFGSKWHKHRKMITPSFHFNILQDFHEVMNENS 151
            .|.:..:.|.:|..:..     ..|.||::  .:| :|:|.|:::..:|..:.|.......||.:
  Rat    98 MSTKYNKDSKMYRAIQTVFGERLFGQGLVSECDYG-RWYKQRRVMDLAFSRSSLVSLMGTFNEKA 161

  Fly   152 AKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNIN--- 213
            .:.|..|:..:.|.|.:..|:.....|:|::...|.|:..:.:......:.||.:.|...|:   
  Rat   162 EQLMEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSMLLGAQKPLSQAVKVMLEGISASR 226

  Fly   214 --MRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNG--------------- 261
              :..|.|.||.        :....:::::.|:....|.:::|..||:.|               
  Rat   227 NTLAKFMPGKRK--------QLREIRESIRLLRQVGKDWVQRRREALKRGEDVPADILTQILKAE 283

  Fly   262 -GSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSR 325
             |:::|             :.||.:.:               ||...||:|:.:.::|:|..|||
  Rat   284 EGAQDD-------------EVLLDNFV---------------TFFIAGHETSANHLAFTVMELSR 320

  Fly   326 HPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGS 390
            .|::..:|..|..||:|  ..|.:.::::.:::||...:||:.|:||......|..:::..|:|.
  Rat   321 QPEIVARLQAEVDEVVG--SKRHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGV 383

  Fly   391 IVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPAP-FEYLPFSAGPRNCIGQKFALLELK 454
            .||..|.|..:..::|..|..|:||..|.|:||....|.| |.|.|||.|.|:||||:||.:|:|
  Rat   384 RVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVK 448

  Fly   455 TVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEK--LKREAGRHKYDPIL 505
            .|::|:::..|                  ..|.|.::  |:.:|.....||:|
  Rat   449 VVMAKLLQRLE------------------FRLVPGQRFGLQEQATLKPLDPVL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 115/467 (25%)
Cyp46a1XP_006240610.1 p450 34..466 CDD:278495 117/489 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.