DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:499 Identity:122/499 - (24%)
Similarity:220/499 - (44%) Gaps:71/499 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGN--ANRIGKNPAEILSTFFDWWYD 65
            |.|:..|:....|..:   |..:.|:|..|    .|.|.:||  |..:.|:..:...|.|   |:
  Fly    10 LVVIGYLIYKWSTATF---KTFEERKLYFE----KPYPFVGNMAAAALQKSSFQRQLTEF---YE 64

  Fly    66 YGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLH-----PWLGHG-------LLT 118
            ..:.:.|  :|:.:   |..|.   ..||..:||:|..:.|..|     |::...       |..
  Fly    65 RTRQHKL--VGFFN---MRTPM---ITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSV 121

  Fly   119 SFGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTI-------IDFQEHANY 176
            ....:|...|..:||.|....:::...:|||:.|:.:..|.  |:..|:       :|.:...|.
  Fly   122 MRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLD--SSSKTLPGRKGFEVDMKVMCNK 184

  Fly   177 LTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPE-FSAYQKTL 240
            |:.|:|..||.|:.:|:.:...:...:..:.:.::..:: |..|..|    :|.|: ||..:.|:
  Fly   185 LSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQ-FFKFMLS----TLVPKLFSLLKLTI 244

  Fly   241 ---KTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGR-PLTRQEIYEEV 301
               ..:..|...::|...|       :|.|:.:.|    ..:..|:.:..:.. ..|..||..:.
  Fly   245 FDSAKVDYFARLVVEAMQY-------REKHNITRP----DMIQLLMEAKNESEDKWTDDEIVAQC 298

  Fly   302 STFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKE 366
            ..|.|...:..::.:..:.|.|..:||||.:||.|..|.........:::..:.||.|:|:.|.|
  Fly   299 FIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISE 363

  Fly   367 AQRVYPSVPFIGRYCDKDYDINGSIVPK------GTTLNLALILLGYNDRIFKDPHHFRPERFEE 425
            :.|.:.......|.|.|||.:......|      |..:|:.:..|..:||.|.:|..|.|:||.|
  Fly   364 SLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSE 428

  Fly   426 EKP---APFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEV 466
            |:.   .|:.||||..|||||||.::||:::|.::..::..:::
  Fly   429 ERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 114/467 (24%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 114/465 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.