DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:536 Identity:186/536 - (34%)
Similarity:284/536 - (52%) Gaps:70/536 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWLAVLALL--VLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTFFDWW 63
            :|.|.|..|  :|..:.|          ::..|...|||...::.|..:     .|||    :|.
  Fly    11 LWAAFLRYLPKILNFLRL----------QRFAKTLPGPTIGELIANVKK-----GEIL----NWL 56

  Fly    64 YDYGKDN---FLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFGSKWH 125
            .:..:.:   |..|.|....::.|:|:.::.:|.:.||:.||..|:||.||||.||||:.|..||
  Fly    57 KELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESWH 121

  Fly   126 KHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVP 190
            :.||::||.|||.||.:|.|.|.||....:.:|:..:.|:: .|...:.....||.||:||||:.
  Fly   122 RRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGES-FDIYPYITLFALDAICETAMGIK 185

  Fly   191 INAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIE-KR 254
            .:|..|.||..|||.:.:|..::.::|..::|.|..|..|......:..||.|.|.|..:|. :|
  Fly   186 KHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRR 250

  Fly   255 VYALQNGGS---KEDHDPSLPRKKMAFLDTLLSSTID-GRPLTRQEIYEEVSTFMFEGHDTTTSG 315
            ...:|....   :.:.|....::::||||.||.:.:: |..|:..:|.|||.||||||||||:|.
  Fly   251 EQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSA 315

  Fly   316 VSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRY 380
            ::|::.|||::||||::.:.|..|:.|         :|...|.||:..|||..|:||||||..|.
  Fly   316 IAFALSLLSKNPDVQQRAFEEASELEG---------REKESMPYLEAVIKETLRIYPSVPFFSRK 371

  Fly   381 CDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERF--EEEKPAPFEYLPFSAGPRNC 443
            ..:|.::....||||.:::..:.:|..:.:.|.||..|.|:||  .|::..||.:..||||||||
  Fly   372 VLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGPRNC 436

  Fly   444 IGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGRHKYDPILSAV 508
            ||||||:|||||.::.::||:..||..|                           |:..|:  |.
  Fly   437 IGQKFAMLELKTSLAMLLRSYRFLPDKD---------------------------HQPKPL--AE 472

  Fly   509 LTLKSDNGLHLRLRER 524
            |..||.||:.||:..|
  Fly   473 LVTKSGNGIRLRILPR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 165/442 (37%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 169/479 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460456
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D10482at33392
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 1 0.900 - - OOG6_100014
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
1110.800

Return to query results.
Submit another query.