DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP4A22

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:551 Identity:163/551 - (29%)
Similarity:261/551 - (47%) Gaps:93/551 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAVLALLVLPLITLVYFERKASQ----RRQLLK---EFNGPTPVPILGNANRIGKNP-----AEI 55
            |.|.:||:|.|:.:     ||:|    |:.|||   :|..|....:.|:......:.     .|.
Human    19 LQVTSLLILLLLLI-----KAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQER 78

  Fly    56 LSTFFDWWYDYGKDNFLFWI-GYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTS 119
            :.||        .....:|| |....:.:.:|..::.||.........: |..|.|.:|:|||..
Human    79 VKTF--------PSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGS-YKFLAPRIGYGLLLL 134

  Fly   120 FGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICD 184
            .|..|.:||:|:||:||.:||:.:..:|.::....:.:.::....|:.::..:|.:.:|||.|..
Human   135 NGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMK 199

  Fly   185 TAMGVPINAMEQRDS-SIVQAFRDM-----CYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTL 243
            :|.....:....|:| |.:||..|:     |...|  |||   .::.::|||.......:..:..
Human   200 SAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRN--AFH---ENDTIYSLTSAGRWTHRACQLA 259

  Fly   244 QDFTYDIIEKRVYALQNGGSKEDHDPSLPRKK-MAFLDTLLSSTID-GRPLTRQEIYEEVSTFMF 306
            ...|..:|:.|...||..|..|    .:.||: :.|||.||.:.:: |..|:.:::..||.||||
Human   260 HQHTDQVIQLRKAQLQKEGELE----KIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMF 320

  Fly   307 EGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDM---NRSVSFQEIAKMKYLDLFIKEAQ 368
            ||||||.||:|:.:|.|:.||.     ::|:|....|.:   ..|:::..:.:|.|..:.||||.
Human   321 EGHDTTASGISWILYALATHPK-----HQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKEAL 380

  Fly   369 RVYPSVPFIGRYCDKDYDI-NGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPAP-- 430
            |:||.||.|||........ :|..:|||..:.|::..|.:|.:::.:...|.|.||     ||  
Human   381 RLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRF-----APGS 440

  Fly   431 ----FEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEK 491
                ..:||||.|.|||||::||:.:||...:..:..||:||....:                  
Human   441 AQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRI------------------ 487

  Fly   492 LKREAGRHKYDPILSAVLTLKSDNGLHLRLR 522
                       ||..|.|.|||.||:|||||
Human   488 -----------PIPMARLVLKSKNGIHLRLR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 133/456 (29%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 145/509 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154741
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.