DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_058781.2 Gene:Cyp19a1 / 25147 RGDID:2457 Length:503 Species:Rattus norvegicus


Alignment Length:505 Identity:114/505 - (22%)
Similarity:219/505 - (43%) Gaps:111/505 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTFFDWWYDYGK 68
            |:..||::.|:.|:         |......:.|.|...||    ||    .::|        :|:
  Rat    25 AMPLLLIMGLLLLI---------RNCESSSSIPGPGYCLG----IG----PLIS--------HGR 64

  Fly    69 DNFLFWIGYSSHIVMTNPKQLEYI---LNSQQ--LIQKSTIYDLLHPWLGHGLLTSFGSKWHKHR 128
              || |:|..|.....|....|::   ::.::  :|.||:  .::|.......::.||||    |
  Rat    65 --FL-WMGIGSACNYYNKMYGEFMRVWISGEETLIISKSS--SMVHVMKHSNYISRFGSK----R 120

  Fly   129 KMITPSFHFNILQDFHEVMNENSAKFMTQ---LKKASAG------------------DTIIDFQE 172
            .:.....|.|.:     :.|.|.:.:.|.   ..||..|                  |.:.|..:
  Rat   121 GLQCIGMHENGI-----IFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRLGDVTD 180

  Fly   173 HANY-----LTLDVICDTA----MGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFK----RSN 224
            ::.|     |...::.||:    :|:|::     :||||:..:..        |:.::    :.|
  Rat   181 NSGYVDVVTLMRHIMLDTSNTLFLGIPLD-----ESSIVKKIQGY--------FNAWQALLIKPN 232

  Fly   225 RVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDG 289
            ..|.::..:..|::::|.|:|....::||:...:.:....||        .|.|...|:.:...|
  Rat   233 IFFKISWLYRKYERSVKDLKDEIEILVEKKRQKVSSAEKLED--------CMDFATDLIFAERRG 289

  Fly   290 RPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEI 354
             .||::.:.:.:...:....||.:..:...:.|::.:|:|:..:.:|...|:|   :|.:...::
  Rat   290 -DLTKENVNQCILEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVG---DRDIRIGDV 350

  Fly   355 AKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRI--FKDPHH 417
            ..:|.::.||.|:.|..|.|..:.|...:|..|:|..|.|||.:   ::.:|...|:  |..|:.
  Rat   351 QNLKVVENFINESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNI---ILNIGRMHRLEYFPKPNE 412

  Fly   418 FRPERFEEEKPAPFEYL-PFSAGPRNCIGQKFALLELKTVISKVVRSFEV 466
            |..|.|  ||..|:.|. ||..|||:|.|:..|::.:|.|:..:::.|.|
  Rat   413 FTLENF--EKNVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 108/474 (23%)
Cyp19a1NP_058781.2 CYP19A1 72..485 CDD:410709 96/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.