DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:561 Identity:154/561 - (27%)
Similarity:265/561 - (47%) Gaps:109/561 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WLAVL-----ALLVLPLITLVYFE--RKASQRRQLLKEFN-GPTPVPILGNANRIGKNPAEILST 58
            ||..|     .||:|..::|:.|:  |...:||.:::..: .|.|             ||.    
Human     5 WLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAP-------------PAH---- 52

  Fly    59 FFDWWYDYGKDNFL--------------------FWIG-----YSSHIVMTNPKQLEYILNSQQL 98
                |: ||...|.                    .|:|     :|.|    :|...:.:|..|. 
Human    53 ----WF-YGHKEFYPVKEFEVYHKLMEKYPCAVPLWVGPFTMFFSVH----DPDYAKILLKRQD- 107

  Fly    99 IQKSTI-YDLLHPWLGHGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKAS 162
             .||.: :.:|..|:|.||:|..||||.|||:::.|.|:.:||:.|..:|:|:....:.:.::..
Human   108 -PKSAVSHKILESWVGRGLVTLDGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHI 171

  Fly   163 AGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNI----NMRAFHPFKRS 223
            |.::.::..:|.:.:|||.|...|..  .....|.||:: .::....:|:    |.|..:....:
Human   172 AQNSRLELFQHVSLMTLDSIMKCAFS--HQGSIQLDSTL-DSYLKAVFNLSKISNQRMNNFLHHN 233

  Fly   224 NRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTID 288
            :.||..:.:...:.|..:.|..||..:|:.|..:|:: ..|:|   :..:::..|||.|||:..:
Human   234 DLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKD-KLKQD---TTQKRRWDFLDILLSAKSE 294

  Fly   289 G-RPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQ 352
            . :..:..::..||.||||.|||||:|.:|:.:|.|:::|:.|::...|..|::|.  ..|::::
Human   295 NTKDFSEADLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGD--GSSITWE 357

  Fly   353 EIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDI-NGSIVPKGTTLNLALILLGYNDRIFKDPH 416
            .:::|.|..:.|||..|:|..|..|.|..||.... :|..:|.|.|:.:.:..|.:|...::||.
Human   358 HLSQMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQ 422

  Fly   417 HFRPERF---EEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDG 478
            .|.|.||   ..||..|:.::|||||.||||||.||::|.|..::..:..|:             
Human   423 VFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFK------------- 474

  Fly   479 RLNTYLGLAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHL 519
                   ||||         |...|.....:.|||.||:|:
Human   475 -------LAPD---------HSRPPQPVRQVVLKSKNGIHV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 131/467 (28%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 143/519 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.