DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and cyp-35D1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_507044.1 Gene:cyp-35D1 / 184495 WormBaseID:WBGene00008829 Length:499 Species:Caenorhabditis elegans


Alignment Length:506 Identity:108/506 - (21%)
Similarity:205/506 - (40%) Gaps:84/506 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRI--------GKNPAEILSTFFD 61
            :|.||.|..||::    .....|::|:...||.|:|::|||::|        |..||      .|
 Worm     2 ILILLFLTAITVI----TVRLYRKVLRFPPGPFPLPLIGNAHQIAYQAWRRGGILPA------LD 56

  Fly    62 WWYDYGKDNFLFWIGYSSHIVMTN--PKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFGSKW 124
            ::.....:.:..|:|..:.:.:|:  ..|..::...::...:.....|.|...|.|||.:.|..|
 Worm    57 YYRKKYGNAYTLWLGPKASVSITDFETSQEVFVKQGKKCYNRQLAPILEHVTGGVGLLIANGENW 121

  Fly   125 HKHRKMITPSFH-----FNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDV-IC 183
            .:.|:....:|.     .||::  ..:|:|.:.:.:....:.:..|..|          :|| ..
 Worm   122 AEMRRFTLLTFRQMGVGTNIME--KRIMDELNGRCLEIDAQIARNDRAI----------VDVKFF 174

  Fly   184 DTAMGVPINAM--------EQRDSSIVQAFRDMCYNIN----------MRAFHPFKRSNRVFSLT 230
            |..:|..||:.        |:....|.:.|.:.....|          ::.|.|.:     |.||
 Worm   175 DLTVGSVINSFLIGKRFEDEEEFLKIKKLFDESSETFNIFDLNVPVWFLKTFLPSR-----FKLT 234

  Fly   231 PEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLT-R 294
            .: |.:|     :.|.....:|:|:..:::|..|.|     |:|....:|..||.......:. .
 Worm   235 WD-SRHQ-----IMDHVMKGVEERIRDIESGAYKID-----PKKPNDVVDAFLSKMKKEEEIAGG 288

  Fly   295 QEIYEEVSTFMFEGHD-------TTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQ 352
            |..|..:.:.....||       ||.:.:......|..||.:.:.:.:|..::..:.. |.::.:
 Worm   289 QHPYYNLKSLKLVLHDLWLAGQGTTATTLYVGFMKLVNHPGIIQNIQKELLDITENGA-RDLTLK 352

  Fly   353 EIAKMKYLDLFIKEAQRVYPSVPFIG--RYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDP 415
            :.....||:..|.|.|| :.|:..:.  |...:....|...|..||.:...:.:|..|:.:|.:|
 Worm   353 DRPNTPYLNATIAEIQR-HASILNVNFWRINHETIHFNDYQVDPGTMIAAQVGVLHVNEELFDNP 416

  Fly   416 HHFRPERFEEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEV 466
            ..|..|::.:......:.:||..|.|:|:|::.|..||..|...::..:.|
 Worm   417 KDFNVEKYLKNPKLLQQVIPFGIGKRSCVGEQIAKSELYLVFGNILLRYNV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 100/476 (21%)
cyp-35D1NP_507044.1 p450 35..496 CDD:299894 96/469 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.