DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus


Alignment Length:492 Identity:127/492 - (25%)
Similarity:232/492 - (47%) Gaps:67/492 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PTPVPILGNANRIGKNPAE----ILSTFFDWWYDYG---KDNFLFWIGYSSHIVMTNPKQLEYIL 93
            |.|..:||:.....|...:    :...|.||...||   :.|    :.|.:.:::|:|:.::..|
Mouse    37 PRPSFLLGHLPYFWKKDEDCGRVLQDVFLDWAKKYGPVVRVN----VFYKTSVIVTSPESVKKFL 97

  Fly    94 NSQQLIQKSTIYDLLHP-----WLGHGLLT--SFGSKWHKHRKMITPSFHFNILQDFHEVMNENS 151
            .|.:..:.|.:|..|..     ..|.||::  .:| :|:|.||::..:|..:.|....|..||.:
Mouse    98 MSTKYNKDSKMYRALQTVFGERLFGQGLVSECDYG-RWYKQRKVMDLAFSRSSLVSLMETFNEKA 161

  Fly   152 AKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNIN--- 213
            .:.:..|:..:.|.|.:..|:.....|:|::...|.|:..:.:......:.||.:.|...|:   
Mouse   162 EQLVEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSMLLGAQKPLSQAVKVMLEGISASR 226

  Fly   214 --MRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKM 276
              :..|.|.||.        :....:::::.|:....|.:::|..||:.|   ||    :|    
Mouse   227 NTLAKFMPGKRK--------QLREIRESIRLLRQVGKDWVQRRREALKRG---ED----MP---- 272

  Fly   277 AFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVM 341
            |.:.|.:....:|.. ..:.:.:...||...||:|:.:.::|:|..|||.|::..:|..|..||:
Mouse   273 ADILTQILKAEEGAQ-DDEVLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVV 336

  Fly   342 GHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLG 406
            |  ..|.:.::::.:::||...:||:.|:||......|..:::..|:|..||..|.|..:..::|
Mouse   337 G--SKRHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMG 399

  Fly   407 YNDRIFKDPHHFRPERFEEEKPAP-FEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAV 470
            ..|..|:||..|.|:||....|.| |.|.|||.|.|:||||:||.:|:|.|::|:::..|     
Mouse   400 RMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIE----- 459

  Fly   471 DELVSTDGRLNTYLGLAPDEK--LKREAGRHKYDPIL 505
                         ..|.|.::  |:.:|.....||:|
Mouse   460 -------------FRLVPGQRFGLQEQATLKPLDPVL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 120/451 (27%)
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 122/473 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.