DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP46A1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens


Alignment Length:509 Identity:125/509 - (24%)
Similarity:225/509 - (44%) Gaps:101/509 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PTPVPILGN------ANRIGKNPAEILSTFFDWWYDYG---KDNFLFWIGYSSHIVMTNPKQLEY 91
            |.|..:||:      .:.:|....:  ..|.||...||   :.|    :.:.:.:::|:|:.::.
Human    37 PRPSFLLGHLPCFWKKDEVGGRVLQ--DVFLDWAKKYGPVVRVN----VFHKTSVIVTSPESVKK 95

  Fly    92 ILNSQQLIQKSTIYDLLHP-----WLGHGLLTSFG-SKWHKHRKMITPSFHFNILQDFHEVMNEN 150
            .|.|.:..:.|.:|..|..     ..|.||::... .:|||.|::|..:|..:.|....|..||.
Human    96 FLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEK 160

  Fly   151 SAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNI--- 212
            :.:.:..|:..:.|.|.:..|:...|..:|::...|.|:..:.:......:.||.:.|...|   
Human   161 AEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITAS 225

  Fly   213 --NMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNG-------------- 261
              .:..|.|.||.        :....:::::.|:....|.:::|..||:.|              
Human   226 RNTLAKFLPGKRK--------QLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKA 282

  Fly   262 --GSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLS 324
              |:::|.         ..||..:                   ||...||:|:.:.::|:|..||
Human   283 EEGAQDDE---------GLLDNFV-------------------TFFIAGHETSANHLAFTVMELS 319

  Fly   325 RHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDING 389
            |.|::..:|..|..||:|  ..|.:.|:::.:::||...:||:.|:||......|..:::..|:|
Human   320 RQPEIVARLQAEVDEVIG--SKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDG 382

  Fly   390 SIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPAP-FEYLPFSAGPRNCIGQKFALLEL 453
            ..||..|.|..:..::|..|..|:||..|.|:||....|.| |.|.|||.|.|:||||:||.:|:
Human   383 VRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEV 447

  Fly   454 KTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEK--LKREAGRHKYDPIL 505
            |.|::|:::..|                  ..|.|.::  |:.:|.....||:|
Human   448 KVVMAKLLQRLE------------------FRLVPGQRFGLQEQATLKPLDPVL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 118/468 (25%)
CYP46A1NP_006659.1 p450 34..466 CDD:365848 120/490 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.