DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and Cyp2c69

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001097995.1 Gene:Cyp2c69 / 100043108 MGIID:3721049 Length:491 Species:Mus musculus


Alignment Length:522 Identity:121/522 - (23%)
Similarity:212/522 - (40%) Gaps:118/522 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIG-KNPAEILSTFFDWWYDYGK 68
            |:.:|.|..:.|:...|:.|.||.|..   ||||:||:||.:.|. |:..:.|:.|..   .||.
Mouse     5 VVLVLCLSFMLLLSLWRQRSARRNLPP---GPTPLPIIGNYHLIDMKDIGQCLTNFSK---TYGP 63

  Fly    69 DNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTI--------------YDLLHPWLGHGLLTS 119
               :|.:.:.|..::        :|:..:.|:::.|              :|.:..  |.|:..|
Mouse    64 ---VFTLYFGSQPIV--------VLHGYEAIKEALIDHGEVFSGRGSFPFFDKVSK--GKGIGFS 115

  Fly   120 FGSKWHKHRKMITPSFHFNILQDFHEVMN---ENSAKFMTQLKKASAGD---------------T 166
            .|:.| |..::.|.:...|:......:.|   |.:...|.:|||.:...               .
Mouse   116 HGNVW-KATRVFTVNTLRNLAMGKRTIENKVQEEAQWLMKELKKTNGSPCDPQFIIGCAPCNVIC 179

  Fly   167 IIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFR------DMCYNINMRAFHPFKRSNR 225
            .|.||...:|...|.:  :.:|......|...|...|.|.      |.|..          |.|:
Mouse   180 SIVFQNRFDYKDKDFL--SLIGKVNECTEILSSPGCQIFNAVPILIDYCPG----------RHNK 232

  Fly   226 VFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSL----PRKKMAFLDTLL--- 283
            .|.......:|             ::||          .::|:.||    ||.   |:|..|   
Mouse   233 FFKNHTWIKSY-------------LLEK----------IKEHEESLDVTNPRD---FIDYFLIQR 271

  Fly   284 --SSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMN 346
              ...|:....|.:.:...|:..:|.|.:|.:|.:.|::.||.:|..:..|:..|...|:|.  :
Mouse   272 RQDKGIEHMEYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVIGR--H 334

  Fly   347 RSVSFQEIAKMKYLDLFIKEAQR---VYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYN 408
            ||...|:...|.|.:..:.|.||   :.|:.......||..:  ....:||||.:..:|..:.::
Mouse   335 RSPCMQDRKHMPYTNAMVHEVQRYVDLGPTSLVHEVTCDTKF--RNYFIPKGTQVMTSLSSVLHD 397

  Fly   409 DRIFKDPHHFRPERFEEE----KPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPA 469
            ...|.:|..|.|..|.::    |.:.: ::|||||.|.|:|:..|.:||...::.::::|::.|.
Mouse   398 STEFPNPEVFDPGHFLDDNGNFKKSDY-FVPFSAGKRICVGESLARMELFLFLTTILQNFKLKPL 461

  Fly   470 VD 471
            ||
Mouse   462 VD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 109/487 (22%)
Cyp2c69NP_001097995.1 p450 30..487 CDD:278495 112/497 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.