DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pelo and YCL001W-B

DIOPT Version :9

Sequence 1:NP_476982.1 Gene:pelo / 34286 FlyBaseID:FBgn0011207 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_076878.1 Gene:YCL001W-B / 850356 SGDID:S000007596 Length:84 Species:Saccharomyces cerevisiae


Alignment Length:79 Identity:26/79 - (32%)
Similarity:49/79 - (62%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 LEQFYMMLQCEPAKAFYGKKHVLQAAESQAIETLLISDNLFRCQDVSLRKEYVNLVESIRDAGGE 342
            ::.|...|..:..||:||.:...:||:..|||||||:|::.:..||..|::|::|:|:..:..|:
Yeast     1 MDDFLEHLSKDDNKAWYGAEETERAAKLDAIETLLITDSVLKRNDVKKREKYLDLIENSGNNNGK 65

  Fly   343 VKIFSSMHISGEQL 356
            :.:.|:..|:...|
Yeast    66 IFVLSTSKITVSNL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peloNP_476982.1 PelA 1..371 CDD:224454 26/79 (33%)
eRF1_1 1..128 CDD:281462
eRF1_2 136..268 CDD:281463
eRF1_3 271..370 CDD:281464 26/79 (33%)
YCL001W-BNP_076878.1 PelA <1..83 CDD:392274 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346718
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S784
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R330
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.