DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pelo and YCL001W-A

DIOPT Version :9

Sequence 1:NP_476982.1 Gene:pelo / 34286 FlyBaseID:FBgn0011207 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_009926.1 Gene:YCL001W-A / 850355 SGDID:S000007221 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:33/146 - (22%)
Similarity:64/146 - (43%) Gaps:36/146 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TTIRKVQNETATG----------SSTSSRVRTTLTIAVESIDFDTQACVLRLKGRNIE----EN- 91
            |.::.:.|....|          :..:..:|.|:|..|          .:|||..:.|    || 
Yeast     2 TFLQFINNNRQEGQGYISEKLFKTKKNEMIRKTVTNLV----------AVRLKNLSHEFDVIENY 56

  Fly    92 -QYVKMGAYHTLDLELNRKFELRKPEWDTIALERIEMACDPTQSADVAAVVMQEGLAHVCLITAS 155
             :|:...:.|.        |...|..::..|.:.::.|.|...:::.|.||:|||.:.:||:.||
Yeast    57 LRYIASTSEHL--------FTAIKRHFNKCARKLLKEAIDSKSNSETATVVLQEGFSGICLLKAS 113

  Fly   156 MTLVRSKIEVSIPRKR 171
            ..::  |:::..|:|:
Yeast   114 SIIL--KLKLKFPKKK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peloNP_476982.1 PelA 1..371 CDD:224454 33/146 (23%)
eRF1_1 1..128 CDD:281462 18/101 (18%)
eRF1_2 136..268 CDD:281463 13/36 (36%)
eRF1_3 271..370 CDD:281464
YCL001W-ANP_009926.1 PelA 1..>153 CDD:392274 33/146 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.