DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and AT1G03920

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001323295.1 Gene:AT1G03920 / 839369 AraportID:AT1G03920 Length:569 Species:Arabidopsis thaliana


Alignment Length:385 Identity:133/385 - (34%)
Similarity:201/385 - (52%) Gaps:63/385 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TTSNKKVDAAETVKE-------FLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIV 63
            ||..||:..|:..:|       |||:.:.|:    .|...:....||||.:..:|.|:||.|.:|
plant    94 TTLEKKLADADVCEEDQTNLMKFLEKKETEY----MRLQRHKMGADDFELLTMIGKGAFGEVRVV 154

  Fly    64 QHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPG 128
            :...|...:|||.|.|.::::..||||...|:.:|..:....:|.|...|:||..||:::||:||
plant   155 REINTGHVFAMKKLKKSEMLRRGQVEHVRAERNLLAEVDSNCIVKLYCSFQDNEYLYLIMEYLPG 219

  Fly   129 GEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKR 193
            |:|.:.|.:....||..::||.|:.|||.|.:|..:.|:||:||:|||:|..|:|:::|||..|.
plant   220 GDMMTLLMRKDTLSEDEAKFYIAESVLAIESIHNRNYIHRDIKPDNLLLDRYGHLRLSDFGLCKP 284

  Fly   194 -----VKGRTWTL--------------------------------------CGTPEYLAPEIILS 215
                 :.|..:|:                                      .|||:|:|||::|.
plant   285 LDCSVIDGEDFTVGNAGSGGGSESVSTTPKRSQQEQLEHWQKNRRMLAYSTVGTPDYIAPEVLLK 349

  Fly   216 KGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGK--VRFP--SHFGSDLKDLLRNLL 276
            |||....|||:||.::|||..|||||:||.|:....|||:.|  ::||  |......:||:..||
plant   350 KGYGMECDWWSLGAIMYEMLVGYPPFYADDPMSTCRKIVNWKTHLKFPEESRLSRGARDLIGKLL 414

  Fly   277 QVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEE 336
             ..:.:|.|:  .|.:.||...||....|..|:|  :||.|||......||.||:.::||
plant   415 -CSVNQRLGS--TGASQIKAHPWFEGVQWEKIYQ--MEAAFIPEVNDDLDTQNFEKFDEE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 120/335 (36%)
AT1G03920NP_001323295.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.