DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and prkx

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_690430.2 Gene:prkx / 561941 ZFINID:ZDB-GENE-090313-408 Length:357 Species:Danio rerio


Alignment Length:317 Identity:161/317 - (50%)
Similarity:224/317 - (70%) Gaps:2/317 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TN-TAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAI 101
            || |..|||.:.|.|:|||:||||.:|:.|.|:.::|:|.:....|::|||.:|..|||.:|..:
Zfish    39 TNRTYTLDDLDTIATVGTGTFGRVFLVKDKKTRGFFALKAMKIPDVIRLKQEQHVHNEKEVLTEV 103

  Fly   102 QFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLI 166
            ..||||.|.:...|:..|||::|||.|||:||:||..|.||.....||:|:||.|.||||..:::
Zfish   104 NHPFLVRLFWTHHDDRFLYMLMEYVNGGELFSYLRSRGHFSNSTGMFYSAEIVCAIEYLHSKEIV 168

  Fly   167 YRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLV 231
            ||||||||:|:||:|::::|||||||::..|||||||||||||||:|.|||:.:||||||||||:
Zfish   169 YRDLKPENILLDSEGHIRLTDFGFAKKLSERTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGVLI 233

  Fly   232 YEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKN 296
            :||.|||||||.|.|..||:||::||:.||.|....:|||::..|..|..:|.||:|.|.:|:|.
Zfish   234 FEMLAGYPPFFDDNPFGIYQKILAGKLEFPRHLDLYVKDLIKKFLVTDRERRLGNMKNGADDVKK 298

  Fly   297 QKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF 353
            .:||.|.:|.::..:|::.|.:|:....|||||||.|.:|..: ..|...||:...|
Zfish   299 HRWFKSVNWESVPCRKLKPPIVPKVSHEGDTSNFDSYPDEEWK-KDTPVPAKDLEIF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 151/288 (52%)
prkxXP_690430.2 PTZ00263 43..357 CDD:140289 158/313 (50%)
STKc_PRKX_like 46..337 CDD:270763 152/290 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 1 1.000 - - FOG0000539
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100326
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.