DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and PRKACB

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_891993.1 Gene:PRKACB / 5567 HGNCID:9381 Length:398 Species:Homo sapiens


Alignment Length:338 Identity:284/338 - (84%)
Similarity:311/338 - (92%) Gaps:2/338 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TVKEFLEQAKEEFEDKWRRNPT-NTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQ 80
            ::||||.:|||:|..|| .||| |.|.|:||||.||||||||||||:|:||.|:.||||||||||
Human    62 SMKEFLAKAKEDFLKKW-ENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQ 125

  Fly    81 KVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPH 145
            |||||||:||||||||||||:.|||||.|.|.||||||||||:|||||||||||||::|||||||
Human   126 KVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPH 190

  Fly   146 SRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAP 210
            :|||||||||.|||||.||||||||||||||||.|||::||||||||||||||||||||||||||
Human   191 ARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAP 255

  Fly   211 EIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNL 275
            ||||||||||||||||||||:|||||||||||||||||||||||||||||||||.||||||||||
Human   256 EIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNL 320

  Fly   276 LQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRI 340
            ||||||||:||||.||:|||..||||:||||||:|:|:||||||:.:|.||||||||||||.:|:
Human   321 LQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRV 385

  Fly   341 SSTEKCAKEFAEF 353
            |.||||||||.||
Human   386 SITEKCAKEFGEF 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 251/288 (87%)
PRKACBNP_891993.1 STKc_PKA 89..378 CDD:271111 251/288 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 479 1.000 Domainoid score I421
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H121718
Inparanoid 1 1.050 605 1.000 Inparanoid score I939
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 1 1.000 - - FOG0000539
OrthoInspector 1 1.000 - - otm41919
orthoMCL 1 0.900 - - OOG6_100326
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R632
SonicParanoid 1 1.000 - - X747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.