DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and LOC556339

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_021328301.1 Gene:LOC556339 / 556339 -ID:- Length:771 Species:Danio rerio


Alignment Length:360 Identity:138/360 - (38%)
Similarity:213/360 - (59%) Gaps:32/360 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKKVDAAETVKEFLEQAKEE--FEDK----------WRRNP---------------TNTAALDDF 46
            |:.|...|.::.:|.:..||  ..|:          :.|:|               ::|:.|.:.
Zfish   397 NEMVGTYEELQAYLREYVEELSLSDERRNAVPQSPLYERSPEAAELRRLKEKATALSSTSFLKEL 461

  Fly    47 ERIKTLGTGSFGRVMIVQHKPTKD-YYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLR 110
            :.:.|||.|.||||.:|:.|.::| .:|:|.:.|:.:|..:|.||..:||.|||.....|:|.|.
Zfish   462 QVVATLGMGGFGRVELVKLKDSEDTAFALKCIKKKHIVDTRQQEHIYSEKIILQQTNSNFIVRLF 526

  Fly   111 YHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENL 175
            ..|:|:..:||:||...|||::|.||.:..|.||.:||....::.||:|||...::|||||||||
Zfish   527 RTFRDDKFVYMLLEVCLGGELWSLLRDMSCFDEPTARFCTGCVLEAFDYLHGKGIVYRDLKPENL 591

  Fly   176 LIDSQGYLKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGY 238
            |:|::||:|:.||||||::  ..:|||.||||||:|||:|::||::...|.|:||:|::|:..|.
Zfish   592 LLDAEGYVKMADFGFAKKIGLGKKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILIFELLIGS 656

  Fly   239 PPFFADQPIQIYEKIVSG--KVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFA 301
            |||....||:||..::.|  ||..|.......:||:|.|.:::..:|.||.|.|:.|||..|||.
Zfish   657 PPFTGSDPIRIYTMVLHGIEKVDIPKRISKRPEDLIRRLCKLNPAERLGNKKNGIIDIKKHKWFQ 721

  Fly   302 STDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEE 336
            ..:|..:.::|:.:|.....|||.|.|.||.:..|
Zfish   722 GFNWEGLRRRKLMSPLRRELKGPLDHSYFDMFPPE 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 126/293 (43%)
LOC556339XP_021328301.1 CAP_ED 177..286 CDD:237999
CAP_ED 295..410 CDD:237999 3/12 (25%)
STKc_cGK 467..727 CDD:270724 116/259 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.