DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and sdr39u1

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001016261.1 Gene:sdr39u1 / 549015 XenbaseID:XB-GENE-1015181 Length:300 Species:Xenopus tropicalis


Alignment Length:141 Identity:34/141 - (24%)
Similarity:47/141 - (33%) Gaps:55/141 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LIDSQGYLKVTDFGFAKRVKGR-TW---TLCGTP---------------------EYLAPEII-- 213
            |::|:|: |||... .:..||| ||   :..|.|                     |....|:|  
 Frog    19 LLNSRGH-KVTIVS-RRPGKGRITWEDVSKIGLPPCDAAVNLAGENVLNPLKRWTEKFKQEVISS 81

  Fly   214 -----------LSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSD 267
                       :||..|....|..:..:.|     |||   .|..|..|:...|...|       
 Frog    82 RIETTRTLTQAISKSPNPPQSWILVTGVGY-----YPP---SQTHQYSEESPGGDADF------- 131

  Fly   268 LKDLLRNLLQV 278
            |..|:|:..||
 Frog   132 LSRLVRDWEQV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 34/141 (24%)
sdr39u1NP_001016261.1 SDR_a8 2..299 CDD:187553 34/141 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.