DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and Prkx

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001029135.1 Gene:Prkx / 501563 RGDID:1564076 Length:358 Species:Rattus norvegicus


Alignment Length:297 Identity:153/297 - (51%)
Similarity:215/297 - (72%) Gaps:0/297 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFL 106
            :|.|::.|.|:|||:||||.:|:.|..:.|.|:||:....|::|||.:|..|||.:|:.|..|||
  Rat    45 SLQDWDTIATVGTGTFGRVNLVKEKTGRRYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFL 109

  Fly   107 VSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLK 171
            :.|.:...||..|||::|:|||||:|::||..||||...:.|||.:||.|.||||..:::|||||
  Rat   110 IKLLWTDHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVAAIFYATEIVCAIEYLHSKEIVYRDLK 174

  Fly   172 PENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAA 236
            |||:|:|.:|::|:|||||||::..|||||||||||||||:|.|||:.:||||||||:|::||.:
  Rat   175 PENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLS 239

  Fly   237 GYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFA 301
            |:||||.|.|..||:||::.|:.||.......|||::.||.||.|:|.||:|.|..|||..:||.
  Rat   240 GFPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWFR 304

  Fly   302 STDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEAL 338
            ..:|.::.|:|::.|.:|:....||.|||:.|.|..|
  Rat   305 GVEWESVPQRKLKPPIVPKLSSDGDISNFETYPEGEL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 149/288 (52%)
PrkxNP_001029135.1 PTZ00263 35..358 CDD:140289 153/297 (52%)
STKc_PRKX_like 47..338 CDD:270763 150/290 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 1 1.000 - - FOG0000539
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100326
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.