DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and for

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster


Alignment Length:356 Identity:135/356 - (37%)
Similarity:212/356 - (59%) Gaps:24/356 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNNATTSNKKVDAA----------ETVKEF---LEQAKEEFEDK--WRRNPTNTAALD----DFE 47
            |::..|:|...::|          ||..:.   |::.|..::|:  ..|...|....|    |..
  Fly   714 GDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDINLTDLR 778

  Fly    48 RIKTLGTGSFGRVMIVQ-HKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRY 111
            .|.|||.|.||||.:|| :..:...:|:|.:.|.::|:.:|.:|.::||.|:......|:|.|..
  Fly   779 VIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFK 843

  Fly   112 HFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLL 176
            .|||...|||::|...|||:::.||..|.|.:..:|||.|.:|.||:|||..::|||||||||||
  Fly   844 TFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLL 908

  Fly   177 IDSQGYLKVTDFGFAKRVK-GR-TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYP 239
            ::.:||:|:.||||||::: || |||.||||||:|||:||::|::.:.|:|:||||::|:..|.|
  Fly   909 LNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTP 973

  Fly   240 PFFADQPIQIYEKIVSG--KVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFAS 302
            ||....|::.|..|:.|  .:.||.:...:..:|::.|.:.:..:|.|..:.|:::|:..|||..
  Fly   974 PFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDG 1038

  Fly   303 TDWIAIFQKKIEAPFIPRCKGPGDTSNFDDY 333
            ..|..:....:|.|..|..|...||:|||||
  Fly  1039 FYWWGLQNCTLEPPIKPAVKSVVDTTNFDDY 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 122/297 (41%)
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736 8/38 (21%)
CAP_ED 638..754 CDD:237999 8/39 (21%)
S_TKc 778..1036 CDD:214567 108/257 (42%)
STKc_cGK 783..1043 CDD:270724 109/259 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.