DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and Pka-C2

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster


Alignment Length:353 Identity:164/353 - (46%)
Similarity:227/353 - (64%) Gaps:9/353 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TSNKKVDAAETVKEFLEQAKEEFEDKWR---RNP-TNTAALDDFERIKTLGTGSFGRVMIVQHKP 67
            ||....::.|.....|:....|||::|.   ::| ||   |:::.....||.||||.||:|:.|.
  Fly     5 TSQYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTN---LENYITRAVLGNGSFGTVMLVREKS 66

  Fly    68 TKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMF 132
            .|:|||.|::.|:.:|:||||.|..|||.:|.|.:||||:.|....|....||::|..|.|||:|
  Fly    67 GKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELF 131

  Fly   133 SHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGR 197
            |:.|:|.:|:|.|:||||||:.||.||:|.:.|:||||||||:|:|.:||:|:|||||.|||.||
  Fly   132 SYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGR 196

  Fly   198 TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFAD--QPIQIYEKIVSGKVRF 260
            |.|||||||||||||:..:.|||:|||||.|:||||..||..||...  ..|.:|.||.....:.
  Fly   197 TSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKM 261

  Fly   261 PSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPG 325
            ||:|.|.|:.|:.:|:|||.:||.||...|.:|:|:..||...||..|..:::.||:.|...|..
  Fly   262 PSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAE 326

  Fly   326 DTSNFDDYEEEALRISSTEKCAKEFAEF 353
            |.|||:::|.:....|...:..:.||.|
  Fly   327 DLSNFENFEFKDRYKSRINRHPELFANF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 147/290 (51%)
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 147/290 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440851
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.