DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and CG12069

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster


Alignment Length:335 Identity:161/335 - (48%)
Similarity:227/335 - (67%) Gaps:3/335 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LEQAKEEFEDKWRRN-PTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKL 85
            |::.:|:|..|:..| |:.:..|||:|...|||:||||:|.:|:.:.:..|||.|.|.|.::||.
  Fly    22 LDKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGKVQLVRERESGVYYASKQLSKDQIVKT 86

  Fly    86 KQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYA 150
            |||.|.::||.:|:::.||..|:|...:||..:||:||..:.|||:|::.|||.:|:|..:||||
  Fly    87 KQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFYA 151

  Fly   151 AQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILS 215
            ||:.||.||||:..|:||||||||:::|..||||||||||||:|:.||.|||||||||.||||.|
  Fly   152 AQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQS 216

  Fly   216 KGYNKAVDWWALGVLVYEMAAGYPPFFAD--QPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQV 278
            |.|..:|||||.||||:|..||:.||.|.  ..:.:|.||.....:.||:|...|:.|:.:||||
  Fly   217 KPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQV 281

  Fly   279 DLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISST 343
            ||:||:|||..|..|||..:||...:||.:..:.:.||::|....|.|.||||...::....:.|
  Fly   282 DLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKT 346

  Fly   344 EKCAKEFAEF 353
            .:..:.||:|
  Fly   347 MRHEEAFADF 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 150/290 (52%)
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 154/311 (50%)
PKc_like 45..335 CDD:304357 149/289 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.