DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and wee2

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001038367.1 Gene:wee2 / 327471 ZFINID:ZDB-GENE-030131-5682 Length:532 Species:Danio rerio


Alignment Length:329 Identity:79/329 - (24%)
Similarity:134/329 - (40%) Gaps:78/329 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAAL-----DDFERIKTLGTGSFGRVMIVQHKP 67
            |:...|.....||....:::|......:.|..:|.:     .:|..:..:|.|.||.|       
Zfish   145 SDDDEDYGPRSKEIQNSSEDESFFLPSKRPAVSARMLSRYESEFLELACIGVGEFGSV------- 202

  Fly    68 TKDYYAMKILDK-QKVVK--LKQVEHTLNEKRILQAI-------QFPFLVSLRYH--FKDNSNLY 120
               |..:|.||. ...:|  .:.:..:.||:..|:.:       ..|.:|  ||:  :.::.::.
Zfish   203 ---YRCVKRLDGCMYAIKRSRRPIAGSANEQLALKEVYAHAVLGHHPHVV--RYYSAWAEDDHMI 262

  Fly   121 MVLEYVPGGEM---FSHLRKVGR-FSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLI---- 177
            :..||..||.:   .:..|:.|. ||.|..|....|:.:..:|:|...|::.|:||.|:.|    
Zfish   263 IQNEYCDGGSLHDAITEKREQGEFFSVPELRDLLLQVSMGLKYIHNSGLVHLDIKPSNIFICRRS 327

  Fly   178 ----------------DSQGYL-KVTDFGFAKRVKGRTWTLCGTPE-------YLAPEIILSKGY 218
                            .|.|.: |:.|.|..        |...:|:       :||.| :|.:.|
Zfish   328 TLSAGGEGDSEEEDESHSSGVVYKIGDLGHV--------TSISSPQVEEGDSRFLAYE-VLREDY 383

  Fly   219 N---KAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKV-RFPSHFGSDLKDLLRNLLQVD 279
            .   || |.:|||:.|. :|||..|.  .|....:.::..|:: ..|....:..||||::||..|
Zfish   384 THLPKA-DIFALGLTVL-LAAGASPL--PQNGDDWHRLRQGELPNLPHELPALFKDLLKSLLDPD 444

  Fly   280 LTKR 283
            .|.|
Zfish   445 PTAR 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 72/288 (25%)
wee2NP_001038367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..166 4/20 (20%)
PTKc_Wee1b 187..459 CDD:271041 72/287 (25%)
Pkinase 194..460 CDD:278497 71/280 (25%)
SPX 433..>516 CDD:271919 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.