DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and Pkcdelta

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster


Alignment Length:358 Identity:124/358 - (34%)
Similarity:206/358 - (57%) Gaps:23/358 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNNATTSNKK-VDAAETVKEFLEQAK--------EEFEDKWRRNPTNTAALDDFERIKTLGTGSF 57
            |..|.:|.|| ::.:.|..:|.:..:        ..|::         .::|||..:..||.|||
  Fly  1522 GGTAPSSPKKMLETSYTYSQFQKSGRFTAPATVIPRFKN---------YSVDDFHFLAVLGKGSF 1577

  Fly    58 GRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQ-AIQFPFLVSLRYHFKDNSNLYM 121
            |:|::.:.:.|..|||:|.|.|..|::...|:.||.|:::|. ..:.|:|..|...|:..|:|:.
  Fly  1578 GKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFF 1642

  Fly   122 VLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVT 186
            |:||:.||::..|:::.|||||..:|||.|:|:...::||...:||||||.:|:|:|.:|::::.
  Fly  1643 VMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIA 1707

  Fly   187 DFGFAK---RVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQ 248
            |||..|   .:.....:.||||:|:|||||..:.||:.||||:.|||:|||..|..||......:
  Fly  1708 DFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDE 1772

  Fly   249 IYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKI 313
            ::..|.:....||.:..::...:|:.||:.|.|||.|:..:...||.:..:|...||..:.:::|
  Fly  1773 LFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLEKRQI 1837

  Fly   314 EAPFIPRCKGPGDTSNFDD-YEEEALRISSTEK 345
            |.||.|:.|.|.||..||. :..|.:|::..:|
  Fly  1838 EPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDK 1870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 113/293 (39%)
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 97/257 (38%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 113/301 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.