DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and Sgk1

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_006227785.1 Gene:Sgk1 / 29517 RGDID:3668 Length:525 Species:Rattus norvegicus


Alignment Length:335 Identity:135/335 - (40%)
Similarity:206/335 - (61%) Gaps:20/335 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRI-LQ 99
            ||  .|...||..:|.:|.||||:|::.:||..:.:||:|:|.|:.::|.|:.:|.::|:.: |:
  Rat   184 NP--HAKPSDFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMSERNVLLK 246

  Fly   100 AIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLD 164
            .::.||||.|.:.|:....||.||:|:.|||:|.||::...|.||.:|||||:|..|..|||.|:
  Rat   247 NVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLN 311

  Fly   165 LIYRDLKPENLLIDSQGYLKVTDFGFAK---RVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWA 226
            ::||||||||:|:||||::.:||||..|   ...|.|.|.||||||||||::..:.|::.||||.
  Rat   312 IVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWC 376

  Fly   227 LGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGV 291
            ||.::|||..|.|||::....::|:.|::..::...:..:..:.||..|||.|.|||.| .|...
  Rat   377 LGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLG-AKDDF 440

  Fly   292 NDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFD-DYEEE------------ALRISST 343
            .:||:..:|:..:|..:..|||..||.|...||.|..:|| ::.||            .|..:|.
  Rat   441 MEIKSHIFFSLINWDDLINKKITPPFNPNVSGPSDLRHFDPEFTEEPVPSSIGRSPDSILVTASV 505

  Fly   344 EKCAKEFAEF 353
            ::.|:.|..|
  Rat   506 KEAAEAFLGF 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 125/293 (43%)
Sgk1XP_006227785.1 S_TKc 192..449 CDD:214567 111/257 (43%)
STKc_SGK 196..518 CDD:270727 130/321 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.