DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and sck1

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_593754.1 Gene:sck1 / 2542492 PomBaseID:SPAC1B9.02c Length:696 Species:Schizosaccharomyces pombe


Alignment Length:324 Identity:134/324 - (41%)
Similarity:197/324 - (60%) Gaps:23/324 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQ 80
            ||:.|.:|..        |..|      :||..::.:|.|:||:|.:|:...|...||||.:.|:
pombe   286 ETIYEHIEHV--------RYGP------EDFTALRLIGKGTFGQVYLVRKNDTNRIYAMKKISKK 336

  Fly    81 KVVKLKQVEHTLNEKRIL---QAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFS 142
            .:|:.|:|.|||.|:.||   ...:.||:|.|::.|:..|:||::.:|:.|||:|.||:..|||.
pombe   337 LIVRKKEVTHTLGERNILVRTSLDESPFIVGLKFSFQTASDLYLITDYMSGGELFWHLQHEGRFP 401

  Fly   143 EPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAK---RVKGRTWTLCGT 204
            |..::||.|::|||.|:||..|:|||||||||:|:|:.|::.:.|||.:|   .....|.|.|||
pombe   402 EQRAKFYIAELVLALEHLHKHDIIYRDLKPENILLDADGHIALCDFGLSKANLSANATTNTFCGT 466

  Fly   205 PEYLAPEIIL-SKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSH-FGSD 267
            .||||||::| .|||.|.||:|:|||||:||..|:.||:|....|:|..|..||||||.. ..|:
pombe   467 TEYLAPEVLLEDKGYTKQVDFWSLGVLVFEMCCGWSPFYAPDVQQMYRNIAFGKVRFPKGVLSSE 531

  Fly   268 LKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFD 331
            .:..:|.||..:...|.|.: |...::|...:||..:|..:.:||::.||.|..:...|.||||
pombe   532 GRSFVRGLLNRNPNHRLGAV-ADTTELKEHPFFADINWDLLSKKKVQPPFKPNVQNDLDVSNFD 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 128/296 (43%)
sck1NP_593754.1 C2 139..294 CDD:301316 3/7 (43%)
S_TKc 302..563 CDD:214567 114/261 (44%)
STKc_Sck1_like 308..633 CDD:270738 126/288 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.