DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and air-1

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_505119.1 Gene:air-1 / 179202 WormBaseID:WBGene00000098 Length:326 Species:Caenorhabditis elegans


Alignment Length:309 Identity:97/309 - (31%)
Similarity:161/309 - (52%) Gaps:44/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLK 86
            ::||:|  |..|        :||||:..:.||.|.||.|.|.:.|.||...|:|:|.|.::::| 
 Worm    30 VDQARE--ESCW--------SLDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQL- 83

  Fly    87 QVEHTL-NEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRF-- 148
            .|.|.| .|..|...::.|.:::|..:|.|:..::::|:|...||:|:.|:     |:|..:.  
 Worm    84 GVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQ-----SQPGHKVNE 143

  Fly   149 -----YAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGF------AKRVKGRTWTLC 202
                 :..|:..|..|.|...:|:||:||||||:||:..||:.|||:      :||     .|||
 Worm   144 VIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKR-----HTLC 203

  Fly   203 GTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSD 267
            ||.:|||||::.::.::..||.||:|:|::||..||.||......::..:|...|:..||.....
 Worm   204 GTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDG 268

  Fly   268 LKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAP 316
            ...|:..:::.:..:|     ..:.||....|......    ::.||.|
 Worm   269 AASLINAIIKKEPQER-----LPLVDIMAHPWIKEMKQ----REDIEVP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 91/287 (32%)
air-1NP_505119.1 STKc_Aurora 43..297 CDD:270909 87/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.