DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and LOC101732362

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_004918050.3 Gene:LOC101732362 / 101732362 -ID:- Length:292 Species:Xenopus tropicalis


Alignment Length:236 Identity:93/236 - (39%)
Similarity:139/236 - (58%) Gaps:6/236 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EKRILQAI---QFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVL 155
            ||||||.:   :.||||||...|:..::|:.|::|:|||::...|...|.|.|..:.||.|.|||
 Frog    19 EKRILQKVTSAEHPFLVSLYATFQSENHLFFVMKYLPGGDLCHLLEHQGAFEESKAMFYTACIVL 83

  Fly   156 AFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAK---RVKGRTWTLCGTPEYLAPEIILSKG 217
            ..|.||..::::||||.|||::|..||||:.|||.:|   |...|:.|.|||..|:|||||....
 Frog    84 GLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIIDEMA 148

  Fly   218 YNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTK 282
            |::|||||||||::|.|.....||.|:..::::|.|.:.|.........:.:.|:..||:.:...
 Frog   149 YSRAVDWWALGVVLYVMIMFQFPFDAEDDMELFESIRNDKPALTEELSEEAQCLILRLLEKNPCH 213

  Fly   283 RYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKG 323
            |.|:.:||..::|..::|...||....:::...||.|...|
 Frog   214 RLGSSEAGAEEVKAHEFFEDIDWEEFLEREQMPPFKPDVSG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 93/236 (39%)
LOC101732362XP_004918050.3 PKc_like 15..292 CDD:419665 93/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.