DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and prkg2

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_002934043.3 Gene:prkg2 / 100497736 XenbaseID:XB-GENE-951552 Length:787 Species:Xenopus tropicalis


Alignment Length:363 Identity:144/363 - (39%)
Similarity:211/363 - (58%) Gaps:33/363 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TSNKKVDAAETVKEFLE--QAKEEFEDKWR--RNPTN-----------------------TAALD 44
            |.||.|...|.:.:.||  .|....:|:.|  ::|.|                       .:..:
 Frog   412 TFNKTVGTYEELMKCLEGYVANLTLDDERRHAKSPVNERHLRAVSMELNKMKQTLARFPSASPFE 476

  Fly    45 DFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSL 109
            :.|.:.|||.|.||||.:|:.|.....:|:|.:.|:.:|..:|.||..:||.||:....||:|.|
 Frog   477 NLEIVTTLGVGGFGRVELVKVKNENLVFALKCIKKRHIVDNRQQEHIHSEKNILEEACSPFIVKL 541

  Fly   110 RYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPEN 174
            ...||||..:||:||...|||::|.||..|.|.||.::|....:..||||||...::||||||||
 Frog   542 YCTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTAKFCTGCVTEAFEYLHQKGVLYRDLKPEN 606

  Fly   175 LLIDSQGYLKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAG 237
            ||:||:||:|:.||||||::  ..:|||.||||||:|||:||:||::.:||:|:||:|:||:..|
 Frog   607 LLLDSEGYVKLVDFGFAKKIFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWSLGILLYELLTG 671

  Fly   238 YPPFFADQPIQIYEKIVSG--KVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF 300
            .|||.....:.||..|:.|  |:.|..:.....:||:|.|.:.:..:|.||:|.|:.|||..:||
 Frog   672 SPPFTGPDQMIIYNLILQGIEKIEFYKNITKRPEDLIRRLCRENPAERLGNMKNGIADIKKHRWF 736

  Fly   301 ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDY--EEE 336
            ...:|..:..:.:.:|..|..:||.|.|.||.|  :||
 Frog   737 NGFNWEGLNTRSLPSPLKPELEGPTDHSYFDSYPPDEE 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 129/292 (44%)
prkg2XP_002934043.3 CAP_ED 194..303 CDD:237999
CAP_ED 312..427 CDD:237999 5/14 (36%)
STKc_cGK 484..743 CDD:270724 119/258 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.