DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and prkx

DIOPT Version :9

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_002941045.1 Gene:prkx / 100494406 XenbaseID:XB-GENE-6046135 Length:369 Species:Xenopus tropicalis


Alignment Length:294 Identity:155/294 - (52%)
Similarity:220/294 - (74%) Gaps:0/294 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLV 107
            ||||:.:.|:|||:||||.:|:.|..|.|:|:|::....|::|||.:|..|||.:|:.:..||||
 Frog    57 LDDFDTVATVGTGTFGRVHLVKEKMGKQYFALKVMSIPDVIRLKQEQHVHNEKSVLKEVNHPFLV 121

  Fly   108 SLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKP 172
            .|.:...|:..|||::|||||||:||:||.:|||:.....||:.:|:.|.||||..:::||||||
 Frog   122 KLFWTSHDDRFLYMLMEYVPGGELFSYLRNMGRFNNSTGLFYSTEIICAIEYLHSKEIVYRDLKP 186

  Fly   173 ENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAG 237
            ||:|:|.:|::|:|||||||::..|||||||||||||||:|.|||:.:||||||||:|::||.:|
 Frog   187 ENILLDKEGHIKLTDFGFAKKLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG 251

  Fly   238 YPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFAS 302
            :||||.|.|..||:||::||:.||.|....:|||::.||.||.|:|.||:|.|.:|:|..:||.|
 Frog   252 FPPFFDDNPFGIYQKILAGKIDFPRHLDLYVKDLIKKLLVVDRTRRLGNMKNGADDVKRHRWFRS 316

  Fly   303 TDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEE 336
            .||..:..:|::.|.||:....||||||:.|.|:
 Frog   317 IDWDTVPPRKLKPPIIPKVTHEGDTSNFEAYPED 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 152/288 (53%)
prkxXP_002941045.1 STKc_PRKX_like 58..349 CDD:270763 153/290 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 1 1.000 - - FOG0000539
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.