DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-S and IRX9

DIOPT Version :9

Sequence 1:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_181246.1 Gene:IRX9 / 818285 AraportID:AT2G37090 Length:351 Species:Arabidopsis thaliana


Alignment Length:331 Identity:76/331 - (22%)
Similarity:131/331 - (39%) Gaps:99/331 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 EEQTTKQMQIRNRHRFDPRIHSMNFRPLNETVHICSESYEDRRQFMQDKPQSDYVQLP---VIYF 212
            |..|..|..:.||    ..|:|.:..|....    |...|...:.:.:|...:.|::.   ::..
plant    63 ENATYTQHSLLNR----TLINSQSQAPAPAE----SREAEGETRSLSEKEDENQVKVTPRGLVIV 119

  Fly   213 VTP--TYPRREQIPELTRLAHTL-LHIPRLHWLV----ADDQEKCNDYM---DTLLYR---FGMP 264
            |||  |..|.:.: .|.|:|:|| |..|.|.|:|    :|.:||.:..|   ..::||   |...
plant   120 VTPIITKDRYKNV-LLRRMANTLRLVPPPLLWIVVEKHSDGEEKSSSTMLRKTGIMYRRIVFKED 183

  Fly   265 FTHMVSPMPSKFRNEKPAPRGVANRRAALQWIRQHNLTNGILYFGDDDNTYDLRLFSEIRKTQRV 329
            ||.:.|.:..:             |..||:.|..|.| :||::|...:|.|||..|.:||..:..
plant   184 FTSLESELDHQ-------------RNLALRHIEHHKL-SGIVHFAGLNNIYDLDFFVKIRDIEVF 234

  Fly   330 SMFPVGLIA----DYGVSGPVVRKGKVVAFLDSWVAGR-------RWPVDMAGFAVN-------- 375
            ..:|:.|::    ...|.|||....:|:    .|...:       :.|:.::.||.|        
plant   235 GTWPMALLSANRKRVVVEGPVCESSQVL----GWHLRKINNETETKPPIHISSFAFNSSILWDPE 295

  Fly   376 ---------------LEYMAQYPYVNMPYKPGYEEDLFLRSIGLQMNLIEPRGNNCTEILVWH-- 423
                           ::|:.|..         .|:|..|:.:..|         :|::|::|.  
plant   296 RWGRPSSVEGTKQDSIKYVKQVV---------LEDDTKLKGLPAQ---------DCSKIMLWRLK 342

  Fly   424 --TQTK 427
              |:|:
plant   343 FPTRTR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 63/272 (23%)
IRX9NP_181246.1 PLN02458 1..350 CDD:215252 76/331 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2254
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D901158at2759
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 1 1.000 - - mtm1177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.