DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-S and B3gat3

DIOPT Version :9

Sequence 1:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_077218.1 Gene:B3gat3 / 72727 MGIID:1919977 Length:335 Species:Mus musculus


Alignment Length:246 Identity:99/246 - (40%)
Similarity:135/246 - (54%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 LPVIYFVTPTYPRREQIPELTRLAHTLLHIPRLHWLVADDQEKCNDYMDTLLYRFGMPFTHM--V 269
            ||.||.:||||.|..|..||.||:.||..:||||||:.:|.|.....:..||...|:.|||:  :
Mouse    74 LPTIYVITPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAESPTPLVSGLLAASGLLFTHLAVL 138

  Fly   270 SPMPSKFRNEKPA---PRGVANRRAALQWIRQHN------------LTNGILYFGDDDNTYDLRL 319
            :|...:.|..:|.   ||||..|..||.|:|...            .|.|::||.||||||...|
Mouse   139 TPKAQRLREGEPGWVRPRGVEQRNKALDWLRGKGGAVGGEKDPPPPGTQGVVYFADDDNTYSREL 203

  Fly   320 FSEIRKTQRVSMFPVGLIADYGVSGPVVRKGKVVAFLDSWVAGRRWPVDMAGFAVNLEYMAQYPY 384
            |.|:|.|:.||::||||:......||.|:.|:||.|..:|...|.:|:|||||||.|..:...| 
Mouse   204 FKEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPNRPFPLDMAGFAVALPLLLAKP- 267

  Fly   385 VNMPYKP----GYEEDLFLRSIGLQMNLIEPRGNNCTEILVWHTQTKSKKL 431
             |..:..    |:.|...|..: :....:|||..|||::|||||:|:..|:
Mouse   268 -NAQFDATAPRGHLESSLLSHL-VDPKDLEPRAANCTQVLVWHTRTEKPKM 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 96/239 (40%)
B3gat3NP_077218.1 GlcAT-I 75..313 CDD:132995 97/240 (40%)
Interaction with galactose moiety of substrate glycoprotein. /evidence=ECO:0000250 243..252 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..335 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.