DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-S and B3GAT1

DIOPT Version :9

Sequence 1:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001354902.1 Gene:B3GAT1 / 27087 HGNCID:921 Length:347 Species:Homo sapiens


Alignment Length:328 Identity:114/328 - (34%)
Similarity:160/328 - (48%) Gaps:58/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KHEGDDRNPGEEEFPGNLSHRAQEIYEYEWNFKIEEQTTKQMQIRNRHRFDPRIHSMNFRPLNET 181
            |.||.|  |..|..||                                 .|||.:..:.|.:.|.
Human    50 KDEGSD--PRRETPPG---------------------------------ADPREYCTSDRDIVEV 79

  Fly   182 VHICSESYEDRRQFMQDKPQSDYVQLPVIYFVTPTYPRREQIPELTRLAHTLLHIPRLHWLVADD 246
            |         |.:::..:|......||.|:.|||||.|..|..||||:|:||||:|.|||||.:|
Human    80 V---------RTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVED 135

  Fly   247 QEKCNDYMDTLLYRFGMPFTHMVSPMPSKFR-----NEKPAPRGVANRRAALQWIRQ----HNLT 302
            ..:.......||...|:.:||:....|..::     .:...|||...|..||:|:|:    ::..
Human   136 APRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSSQ 200

  Fly   303 NGILYFGDDDNTYDLRLFSEIRKTQRVSMFPVGLIADYGVSGPVVR-KGKVVAFLDSWVAGRRWP 366
            .|::||.||||||.|.||.|:|.|:|||::||..:.......|.|. .||||.:...:...|.:.
Human   201 PGVVYFADDDNTYSLELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFA 265

  Fly   367 VDMAGFAVNLEYMAQ--YPYVNM-PYKPGYEEDLFLRSIGLQMNLIEPRGNNCTEILVWHTQTKS 428
            :|||||||||..:.|  ..|..: ..|.||:|...||.: :.:|.:||:..|||:||||||:|:.
Human   266 IDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLREL-VTLNDLEPKAANCTKILVWHTRTEK 329

  Fly   429 KKL 431
            ..|
Human   330 PVL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 95/231 (41%)
B3GAT1NP_001354902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.