DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-S and GlcAT-I

DIOPT Version :9

Sequence 1:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_726910.1 Gene:GlcAT-I / 251900 FlyBaseID:FBgn0066114 Length:306 Species:Drosophila melanogaster


Alignment Length:249 Identity:92/249 - (36%)
Similarity:140/249 - (56%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 QSDYVQ---LPVIYFVTPTYPRREQIPELTRLAHTLLHIPRLHWLVADDQEKCNDYMDTLLYRFG 262
            |:.:||   ||.||.|||||||..|..|||||:|..:.:|.|||::.:|.......:..||.|.|
  Fly    40 QAMFVQGDTLPTIYAVTPTYPRPAQKAELTRLSHLFMLLPHLHWIIVEDTNATTPLVRNLLDRAG 104

  Fly   263 M----PFTHMVSPMPSKFRNEKP---APRGVANRRAALQWIRQHNLT--NGILYFGDDDNTYDLR 318
            :    ...::.:|...|.:.:.|   .||||..|..||.|:|.|...  :.|::|.||||:|...
  Fly   105 LEKRSTLLNIKTPSEFKLKGKDPNWIKPRGVEQRNLALAWLRNHVDVDRHSIVFFMDDDNSYSTE 169

  Fly   319 LFSEIRKTQ--RVSMFPVGLIADYGVSGPVVRKG--KVVAFLDSWVAGRRWPVDMAGFAVNLEYM 379
            ||:|:.|.:  ||.::||||:....|..|::.:.  ||..|..:|...|.:|:|||.||::::..
  Fly   170 LFAEMSKIERGRVGVWPVGLVGGLMVERPLLTEDGTKVTGFNAAWRPERPFPIDMAAFAISMDLF 234

  Fly   380 AQYPYVNMPY--KPGYEEDLFLRSIGLQMNLIEPRGNNCTEILVWHTQTKSKKL 431
            .:.|.....|  :.||:|...||.:..: :.::|..|.||::|||||:|:..||
  Fly   235 IRNPQATFSYEVQRGYQESEILRHLTTR-DQLQPLANRCTDVLVWHTRTEKTKL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 85/233 (36%)
GlcAT-INP_726910.1 GlcAT-I 50..284 CDD:132995 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I2254
eggNOG 1 0.900 - - E1_KOG1476
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2271
Isobase 1 0.950 - 0 Normalized mean entropy S3762
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101124at50557
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 1 1.000 - - mtm1177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
109.920

Return to query results.
Submit another query.