DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-S and B3gat1

DIOPT Version :9

Sequence 1:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_446455.1 Gene:B3gat1 / 117108 RGDID:70880 Length:347 Species:Rattus norvegicus


Alignment Length:328 Identity:117/328 - (35%)
Similarity:161/328 - (49%) Gaps:58/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KHEGDDRNPGEEEFPGNLSHRAQEIYEYEWNFKIEEQTTKQMQIRNRHRFDPRIHSMNFRPLNET 181
            |.||.|  |..|..||                                 .|||.:.|:.|.:.|.
  Rat    50 KDEGSD--PRHEAPPG---------------------------------ADPREYCMSDRDIVEV 79

  Fly   182 VHICSESYEDRRQFMQDKPQSDYVQLPVIYFVTPTYPRREQIPELTRLAHTLLHIPRLHWLVADD 246
            |         |.:::..:|......||.|:.|||||.|..|..||||:|:||||:|.|||||.:|
  Rat    80 V---------RTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVED 135

  Fly   247 QEKCNDYMDTLLYRFGMPFTHMVSPMPSKFR-----NEKPAPRGVANRRAALQWIRQ---HNLTN 303
            ..:.......||...|:.:||:....|..::     .:...|||...|..||:|:|:   .|.|.
  Rat   136 APRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSTQ 200

  Fly   304 -GILYFGDDDNTYDLRLFSEIRKTQRVSMFPVGLIADYGVSGPVVR-KGKVVAFLDSWVAGRRWP 366
             |::||.||||||.|.||.|:|.|:|||::||..:.......|.|. .||||.:...:...|.:.
  Rat   201 PGVVYFADDDNTYSLELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFA 265

  Fly   367 VDMAGFAVNLEYMAQ--YPYVNM-PYKPGYEEDLFLRSIGLQMNLIEPRGNNCTEILVWHTQTKS 428
            :|||||||||..:.|  ..|..: ..|.||:|...||.: :.:|.:||:..|||:||||||:|:.
  Rat   266 IDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLREL-VTLNDLEPKAANCTKILVWHTRTEK 329

  Fly   429 KKL 431
            ..|
  Rat   330 PVL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 97/231 (42%)
B3gat1NP_446455.1 Glyco_transf_43 118..328 CDD:397440 84/210 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X314
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.