DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and TRX2

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_011725.3 Gene:TRX2 / 853123 SGDID:S000003441 Length:104 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:50/107 - (46%)
Similarity:70/107 - (65%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASG-KLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECE 64
            ||.|:|..::.|..|  ||| ||||:|||||||||||||:|.:.:.:.|::| ....|:||||..
Yeast     1 MVTQLKSASEYDSAL--ASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSD-AAFYKLDVDEVS 62

  Fly    65 DIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 106
            |:|.:..:|||||.:|.|.|.:|....|||...::..|.:|:
Yeast    63 DVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 42/85 (49%)
TRX2NP_011725.3 thioredoxin 6..104 CDD:200072 46/100 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1788
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1472
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9210
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
1312.710

Return to query results.
Submit another query.