DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and TRX1

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_013144.1 Gene:TRX1 / 850732 SGDID:S000004033 Length:103 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:48/107 - (44%)
Similarity:67/107 - (62%) Gaps:7/107 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQF--ADNVVVLKVDVDEC 63
            ||.|.|..::.|..:  |..||||:||:||||||||||:|.:.:.|.|:  ||   ..|:||||.
Yeast     1 MVTQFKTASEFDSAI--AQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQAD---FYKLDVDEL 60

  Fly    64 EDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN 105
            .|:|.:..:|:|||.:..|||.:|.:..|||...::..|.||
Yeast    61 GDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 40/86 (47%)
TRX1NP_013144.1 thioredoxin 6..103 CDD:200072 45/102 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1788
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1472
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9210
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.