DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and TRX3

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_010006.1 Gene:TRX3 / 850444 SGDID:S000000679 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:89 Identity:44/89 - (49%)
Similarity:57/89 - (64%) Gaps:2/89 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFV 79
            |.|.:.|||: ||:|||||||||:.|.|.:|...:.| |..:|.||||..|||.|..:::|||||
Yeast    39 LIKQNDKLVI-DFYATWCGPCKMMQPHLTKLIQAYPD-VRFVKCDVDESPDIAKECEVTAMPTFV 101

  Fly    80 FLKNGVKVEEFAGANAKRLEDVIK 103
            ..|:|..:.:..|||...||..||
Yeast   102 LGKDGQLIGKIIGANPTALEKGIK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 40/84 (48%)
TRX3NP_010006.1 TRX_family 35..125 CDD:239245 42/87 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342117
Domainoid 1 1.000 89 1.000 Domainoid score I1788
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128202
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9210
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
1110.610

Return to query results.
Submit another query.