DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx2 and THM1

DIOPT Version :10

Sequence 1:NP_523526.1 Gene:Trx2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_849585.1 Gene:THM1 / 839436 AraportID:AT1G03680 Length:179 Species:Arabidopsis thaliana


Alignment Length:95 Identity:34/95 - (35%)
Similarity:52/95 - (54%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMP 76
            |..:.||. :.|.:||:|.||||||||.|.:.||:.::|......|::.||......:|.:.|:|
plant    85 DSLVLKAD-EPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSIP 148

  Fly    77 TFVFLKNGVKVEEFAGANAKRLEDVIKANI 106
            |.:...||.|.:...||.:|   |.:..:|
plant   149 TIMIFVNGEKKDTIIGAVSK---DTLATSI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx2NP_523526.1 TRX_family 18..103 CDD:239245 31/84 (37%)
THM1NP_849585.1 CnoX 79..179 CDD:442352 34/95 (36%)

Return to query results.
Submit another query.