DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx2 and HCF164

DIOPT Version :10

Sequence 1:NP_523526.1 Gene:Trx2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_195437.1 Gene:HCF164 / 829874 AraportID:AT4G37200 Length:261 Species:Arabidopsis thaliana


Alignment Length:66 Identity:22/66 - (33%)
Similarity:39/66 - (59%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD--NVVVLKVDVDECEDIAMEYNISSMPTFVF 80
            ::||..|::|:|.||..|:.::|.:.::..|:.|  |.|:|.||..:.|....|:.:..:|.|.|
plant   136 SNGKPTVVEFYADWCEVCRELAPDVYKIEQQYKDKVNFVMLNVDNTKWEQELDEFGVEGIPHFAF 200

  Fly    81 L 81
            |
plant   201 L 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx2NP_523526.1 TRX_family 18..103 CDD:239245 22/66 (33%)
HCF164NP_195437.1 TxlA 119..260 CDD:239248 22/66 (33%)

Return to query results.
Submit another query.