DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx2 and TTL4

DIOPT Version :10

Sequence 1:NP_523526.1 Gene:Trx2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_191421.2 Gene:TTL4 / 825031 AraportID:AT3G58620 Length:682 Species:Arabidopsis thaliana


Alignment Length:100 Identity:30/100 - (30%)
Similarity:49/100 - (49%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QVKDKADLDGQLTKAS-GKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIA 67
            :|::.:.||...|..| ..:.|..|.::.....:.|||.:..|..:: ..|...||||:|...:|
plant   579 EVEEVSTLDKFKTATSLPGISVFHFKSSSNRQSEAISPFVNTLCLRY-PLVHFFKVDVEESLALA 642

  Fly    68 MEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102
            ...:|..:|||...|.|.||:|....:.:.|||.:
plant   643 KAESIKKIPTFKIYKKGEKVKEMVCPSHQLLEDSV 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx2NP_523526.1 TRX_family 18..103 CDD:239245 26/85 (31%)
TTL4NP_191421.2 TadD <204..302 CDD:444034
TPR repeat 215..239 CDD:276809
TPR repeat 244..274 CDD:276809
TPR repeat 279..302 CDD:276809
TPR 401..>574 CDD:440225
TPR repeat 402..430 CDD:276809
TPR repeat 482..512 CDD:276809
TPR repeat 517..541 CDD:276809
TRX_family 589..674 CDD:239245 24/85 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.