DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx2 and TDX

DIOPT Version :10

Sequence 1:NP_523526.1 Gene:Trx2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_188415.2 Gene:TDX / 821056 AraportID:AT3G17880 Length:380 Species:Arabidopsis thaliana


Alignment Length:104 Identity:45/104 - (43%)
Similarity:69/104 - (66%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYQVKDKADLDGQLTKASGK---LVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDEC 63
            |..:...::|:.: |||:.|   |::|.|.|||||||:.:||....|:||.: .||.||||:|:.
plant   272 VISIHSTSELEAK-TKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLKVDIDKA 334

  Fly    64 EDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102
            .|:|..:||||:|||.|:::|.:|::..||:...||..|
plant   335 NDVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx2NP_523526.1 TRX_family 18..103 CDD:239245 41/88 (47%)
TDXNP_188415.2 Hip_N 6..44 CDD:271228
TPR <108..267 CDD:440225
TPR repeat 112..140 CDD:276809
TPR repeat 145..175 CDD:276809
TPR repeat 180..206 CDD:276809
TRX_family 292..374 CDD:239245 39/83 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.